Cotton on black shirt: Women’s SALE Shirts & Blouses

Содержание

404 PAGE NOT FOUND | CELINE

NATIONALITY / PASSPORT (OPTIONAL)

PREFER NOT TO SAYAFGHANISTANALAND ISLANDSALBANIAALGERIAANDORRAANGOLAANGUILLAANTARCTICAANTIGUA AND BARBUDAARGENTINAARMENIAARUBAAUSTRALIAAUSTRIAAZERBAIJANBAHAMASBAHRAINBANGLADESHBARBADOSBELARUSBELGIUMBELIZEBENINBERMUDABHUTANBOLIVIABONAIRE, SAINT EUSTATIUS AND SABABOSNIA AND HERZEGOVINABOTSWANABOUVET ISLANDBRAZILBRITISH INDIAN OCEAN TERRITORYBRITISH VIRGIN ISLANDSBRUNEI DARUSSALAMBULGARIABURKINA FASOBURUNDICAMBODIACAMEROONCANADACAPE VERDECAYMAN ISLANDSCENTRAL AFRICAN REPUBLICCHADCHILECHRISTMAS ISLANDCOCOS (KEELING) ISLANDSCOLOMBIACOMOROSCONGO (DEMOCRATIC REPUBLIC OF)CONGO (REPUBLIC)COOK ISLANDSCOSTA RICACROATIACUBACURAÇAOCYPRUSCZECH REPUBLICDENMARKDJIBOUTIDOMINICADOMINICAN REPUBLICECUADOREGYPTEL SALVADOREQUATORIAL GUINEAERITREAESTONIAETHIOPIAFALKLAND ISLANDSFAROE ISLANDSFIJIFINLANDFRANCEFRENCH GUIANAFRENCH POLYNESIAFRENCH SOUTHERN TERRITORIESGABONGAMBIAGEORGIAGERMANYGHANAGIBRALTARGREECEGREENLANDGRENADAGUADELOUPEGUATEMALAGUERNSEYGUINEAGUINEA-BISSAUGUYANAHAITIHAWAIIHEARD ISLAND AND MCDONALD ISLANDSHONDURASHONG KONG SAR OF PRCHUNGARYICELANDINDIAINDONESIAIRAN (ISLAMIC REPUBLIC OF)IRAQIRELANDISLE OF MANISRAELITALYIVORY COASTJAMAICAJAPANJERSEYJORDANKAZAKHSTANKENYAKIRIBATIKOREA, DEMOCRATIC PEOPLE’S REPUBLIC OFKOREA, REPUBLIC OFKUWAITKYRGYZSTANLAOS, LAO PEOPLE’S DEMOCRATIC REPUBLICLATVIALEBANONLESOTHOLIBERIALIBYALIECHTENSTEINLITHUANIALUXEMBOURGMACAU SAR OF PRCMACEDONIAMADAGASCARMALAWIMALAYSIAMALDIVESMALIMALTAMARTINIQUEMAURITANIAMAURITIUSMAYOTTEMEXICOMOLDOVAMONACOMONGOLIAMONTENEGROMONTSERRATMOROCCOMOZAMBIQUEMYANMARNAMIBIANAURUNEPALNETHERLANDSNEW CALEDONIANEW ZEALANDNICARAGUANIGERNIGERIANIUENORFOLK ISLANDNORWAYOMANPAKISTANPALESTINIAN TERRITORYPANAMAPAPUA NEW GUINEAPARAGUAYPEOPLE’S REPUBLIC OF CHINAPERUPHILIPPINESPITCAIRNPOLANDPORTUGALQATARREUNIONROMANIARUSSIARWANDASAINT BARTHELEMYSAINT HELENA, ASCENSION AND TRISTAN DA CUNHASAINT KITTS AND NEVISSAINT LUCIASAINT MARTIN (FRENCH PART)SAINT PIERRE AND MIQUELONSAINT VINCENT AND THE GRENADINESSAMOASAN MARINOSAO TOME AND PRINCIPESAUDI ARABIASENEGALSERBIASEYCHELLESSIERRA LEONESINGAPORESINT MAARTEN (DUTCH PART)SLOVAKIASLOVENIASOLOMON ISLANDSSOMALIASOUTH AFRICASOUTH GEORGIA AND THE SOUTH SANDWICH ISLANDSSOUTH SUDANSPAINSRI LANKASUDANSURINAMESVALBARD AND JAN MAYENSWAZILANDSWEDENSWITZERLANDSYRIA (ARAB REPUBLIC)TAIWAN REGIONTAJIKISTANTANZANIATHAILANDTIMOR-LESTETOGOTOKELAUTONGATRINIDAD AND TOBAGOTUNISIATURKEYTURKMENISTANTURKS AND CAICOS ISLANDSTUVALUUGANDAUKRAINEUNITED ARAB EMIRATESUNITED KINGDOMUNITED STATESURUGUAYUZBEKISTANVANUATUVATICANVENEZUELAVIETNAMWALLIS AND FUTUNAWESTERN SAHARAYEMENZAMBIAZIMBABWE

Equator Shirt. Black edition. Available at vollebak.com

Equator Shirt. Black edition. Available at vollebak.com

Loading…

FREE WORLDWIDE SHIPPING AND FREE RETURNS

FREE WORLDWIDE SHIPPING AND FREE RETURNS

FREE WORLDWIDE SHIPPING AND FREE RETURNS

Skip to content

Loading …
£245
€280
$345

Choose your size
Size

Size guide

Home to some of the hottest and most humid places on the planet, the equator carves through dense tropical jungles, warm seas, and crowded cities. Instead of seasons or temperature changes you’re more likely to be hit by a wall of heat, sun, rain and humidity. But as global temperatures rise and climate zones shift, designing clothing for the equator is like designing for our future. So the Equator Shirt is built to keep you comfortable in all 40,000km of one of the most extreme environments we currently inhabit. The shirt starts with one of the lightest and softest fabrics on the planet, a rare, silk-like cotton from the Nile Delta. We then turned this into a phenomenally lightweight technical shirt by adding stretch, strength, UV protection, and buttons carved from corozo nuts anchored on military tape. And with every detail designed to keep you cool, we engineered the shirt with the most advanced ventilation system we’ve ever made – 18 concealed air vents built with laser cutting and super soft Italian mesh that work together like built-in air-con.

Technical details

Open Accordion

  • Material made in Italy: 72% cotton, 24% polyamide, 4% elastane
  • Shirt weighs 200 grams
  • 4 way stretch throughout the shirt
  • 18 concealed air vents
  • 6 air vents over the shoulders reinforced with bartacks
  • 8 air vents across the back reinforced with bartacks
  • 2 underarm air vents constructed with a high-stretch Italian mesh fabric: 75% polyester, 25% elastane
  • 2 perforated chest air vents concealed inside chest pockets
  • 2 zipped chest pockets with lockable zippers
  • All seams are twin needle stitched with two lines of stitching to double the strength
  • 12 shatterproof, heat resistant buttons made from corozo nuts
  • All buttons are anchored on their own heavy duty woven polyester military tape with reinforced stitching
  • Reinforced hanging loop at the back neck
  • Two-piece sleeves engineered for movement
  • A 20cm strap inside each sleeve with two buttonhole settings to hold rolled-up sleeves in place
  • Drop-tail back hem
  • Cool wash max temp 40°C
  • Tumble dry low

Size + fit

Open Accordion

Fit guide: The Equator Shirt has a regular fit, but if you’re on the borderline between two chest sizes, or prefer a looser fit overall, we recommend you go for the size up.

Model wears: Greg Kheel is 6ft 2 / 188cm with a 39 inch / 99cm chest. Greg has an athletic build and is wearing the Equator Shirt in size L.

Personalised advice: See our size guide for more advice on sizing, or you can ask us for personalised sizing advice here.

Returns and exchanges: Don’t worry if you order something and it doesn’t fit – we have a free, no hassle 30 day return and exchange period.

XS S M L XL XXL
Fits chest 83-90 91-98 99-106 107-114 115-122 123-130
Fits waist 71-76 76-81 81-86 86-91 91-96 96-101
XS S M L XL XXL
Fits chest 33-36 36-39 39-42 42-45 45-48 48-51
Fits waist 28-30 30-32 32-34 34-36 36-38 38-40

Size Table Swipe

Swipe to see more

We start with the softest cotton from the Nile Delta

Life at the equator offers us a glimpse of our future – a world of non-stop sun, heat, humidity and rainstorms. So we’ve built the Equator Shirt to equip you for it. To build a shirt that can work in all 40,000km of the equator we started with a world-class base material – a rare cotton called Karnak Menoufi. One of the lightest, softest fabrics on the planet, Karnak Menoufi is a silk-like cotton that’s only found in the Nile Delta, and only grows in the years when the rain, soil and wind conditions are perfect.

We turn cotton into a high performance fabric

While Karnak Menoufi is already extremely soft and robust, we’ve added durability and stretch by combining the cotton with elastane and an ultrafine nylon in Italy. Together the combination is so soft and lightweight that it has to be spun and woven with the same techniques and on the same looms that are used for silk. The result is an advanced, abrasion resistant material which feels almost silk-like next to your skin.

Ultra lightweight at just 200 grams

As global temperatures rise and climate zones shift, clothes have to respond. Weighing just 200 grams, the Equator Shirt is the most technical lightweight shirt ever built, and exactly half the weight of our Planet Earth Shirt. Built for the heat, the Equator Shirt is highly breathable, ultra lightweight and packable – so it’s perfect for any adventure. Whether it’s on your back or in your backpack you’ll never notice it’s there.

18 concealed air vents work like in-built air-con

We’ve built 18 concealed air vents throughout the shirt to cool you down, with three different methods of engineering. Designed for hot, humid and arid environments, each vent opens and closes either with body movement or with zip closures. And we’ve put them in the places you’ll need them the most – over your shoulders, across your back, under your arms, and on your chest. Working down from the collar you’ll find the first six air vents that allow air to flow in over your shoulders. Each air vent is securely fixed with bartacks.

Two chest pockets with hidden vents

The two chest pockets are built with angled lockable zippers. Inside each of the pockets are hidden vents for when you need to cool down. Simply unzip each pocket to reveal perforated laser cut panels that will create multiple air streams. When you’re moving fast this will channel any air from the outside directly towards your chest to cool you faster.

Two mesh underarm vents

Underneath each arm you’ll find an open vent lined with a feather-soft, super elastic, lightweight Italian mesh fabric. It’s fast drying and incredibly breathable so sweat can escape easily and air can flow into your shirt to cool you quickly. The sleeves are engineered to move with you, so they’re cut like sports gear rather than an office shirt.

Air-con for your upper back

The last 8 air vents are positioned across your upper back. These are engineered to stay open and bring constant airflow. Two layers of fabric overlap and are securely fixed with bartacks. It means they won’t blow open and your skin will stay protected, but the air can flow in.

Four way stretch and twin needle stitched for performance

The last thing you want when you’re pulling any extreme or repetitive move in the heat is resistance from your kit. The Equator Shirt has 4 way stretch, so whichever way you stretch, pull or turn, it will simply go with you. We’ve also used twin needle stitching on every seam, which is two lines of stitching instead of one to double the strength.

The shirt’s invisible tech blocks invisible UV rays

Just like sunblock, fabric can be rated for its ability to reduce your exposure to the sun’s ultraviolet light. The Ultraviolet Protection Factor, or UPF, shows how much more protection your skin would have while wearing that piece of clothing. A UPF rating of 15 for example would give your skin 15x more protection than it would have if it was unprotected. The shirt scores a UPF of 50+ which is the highest possible rating, giving you the highest possible protection, wherever you are.

It’s fast drying from rain and humidity

Humidity and rainstorms are going to soak you one way or another at the equator, so the key is about drying really fast, rather than trying to avoid getting wet. The fabric is ultra lightweight and elastic so it dries quickly, making the shirt as at home in a rainforest as it is in a city. And the extra airflow from the ventilation will help your skin dry faster at the same time as the shirt.

Impact-resistant buttons made from corozo nuts

Every button on the shirt starts life as a corozo nut buried inside the spiky fruit of the Tagua Palm trees found on the coastal mountain ranges of South America. Corozo is phenomenally strong so can be carved with stunning precision. It’s highly resistant to scratches, extreme temperatures and impact, so won’t crack or splinter. Made from 100% organic fibre, each button has a unique grain just like a fingerprint, so no two will ever be the same. And all buttons are sculpted with a highly polished 30 degree taper towards the edges to make them easy to slip into place.

Free-floating buttons anchored on military tapes

Even the way the shirt buttons up has been engineered to work with sweaty hands and hostile conditions. Rather than being sewn onto the shirt, the buttons on the front of the shirt have all been threaded onto a high-strength woven polyester tape that runs the shirt’s entire length. The tape is then stitched onto reinforced panels above and below each button. The construction allows the shirt to stretch and flex with you, as each button is free to slide 2 centimetres up and down its section of military tape.

Engineered sleeves that stay up in any condition

If you’re moving hard and fast and want your sleeves to stay rolled, you’ll find a 20cm long reinforced strap on the inside of each sleeve that you can pull out, up and over the rolled sleeve and fasten to a small slip button on the outside of the upper arm. The fastening is secured on its own reinforced patch of military tape. And each 20cm fabric strap has two buttonhole settings so you can choose how high you want them. If you’re wearing the sleeves down, the cuffs fasten with two corozo buttons.

  • Vollebak aims to do for outdoor clothing what Tesla did for cars and El Bulli did for food, using science, wit and imagination to create products no-one thought possible.

Works well with

Cricut Infusible Ink T-Shirts: Which Ones Work Best?

You can put Cricut Infusible Ink on so many things! Find out what T-SHIRTS you can put Infusible Ink transfer sheets AND how they stand up to the washer and dryer. Plus, get a trick for black shirts!

I’ve been testing Cricut Infusible Ink on a variety of T-shirts beyond the official Cricut T-shirts. Why? Well, Cricut shirts only come in a limited range of sizes, and they’re all white. When deciding what other kinds of T-shirts we can use, we want to pay attention to MATERIAL CONTENT and COLOR. For Infusible Inks to transfer to T-shirts properly, they need to bind with polyester surfaces. And because the Infusible Inks are transparent rather than opaque, they need to be on white or light colored surfaces. A good T-shirt for Infusible Ink is one that has a hiqh polyester count and is white or pastel.

So I’ve been putting Cricut Infusible Ink on lots of different types of T-Shirts! And then I washed them ALL to see what they looked like afterward. Want to see?

To find out how the T-shirts turned out, watch the playtest video of 19 different T-shirts with Cricut Infusible Ink here!

Here’s a list of all the T-shirts I’ve tried Cricut Infusible Inks on so far. This post contains some affiliate links for your convenience (which means if you make a purchase after clicking a link I will earn a small commission but it won’t cost you a penny more)! Read my full disclosure policy.

White T-Shirts

Quick Links to Information in this Post

100% polyester – white – Hanes Cool Dri (Amazon) – These worked REALLY well!

92% polyester/8% spandex – white – No Boundaries – Wal-Mart – These T-shirts also took the Infusible Ink well!

95% polyester/5% spandex – white (Cricut Brand at Michaels) – This is an official Infusible Ink blank from Cricut and is guaranteed to work.

90% polyester/10% spandex – white – Terra & Sky (Wal-mart) – The design didn’t evenly infuse into the material, and I’m not sure if it is a faulty shirt or user error.

80% polyester/20% cotton – white – Fruit of the Loom (Amazon) – These look great and washed well!

65% polyester/35% cotton – white – George (Wal-mart) – These worked pretty well, though you can see how the image isn’t as vibrant to begin with and has a wee bit of fading after one wash.

40% polyester/60% cotton – white – George (Wal-mart) – While the Infusible Ink applied well to the shirt, you can see how much fading occurred after just one wash. Avoid this shirt.

100% cotton – white – Fruit of the Loom (Amazon)

Colored T-Shirts

100% polyester – blue – Hanes

92% Polyester / 8% Spandex –  Gold – No Boundaries (Wal-mart)

80% Polyester / 20% cotton – Hot Pink – Athletic Works (Wal-mart)

65% Polyester / 35% Cotton – Pink/Blue/Purple George (Wal-mart)

50% polyester / 50% Cotton – Blue – Gildan (Michaels)

40% polyester – 60% cotton – Pink & Blue – George (Wal-mart)

100% polyester – Green – Gildan (Michaels)

Black T-Shirts

40% polyester – 60% cotton – Black – George (Wal-mart) – You cannot even see the Infusible Ink because it is transparent!

As you can see, Cricut Infusible Ink does not show up on dark and black shirts. But if you put a WHITE layer on first, then put the Infusible Ink onto the white layer, it does work! Here are my experiments using Siser StripFlock HTV (top) and Cricut White Glitter Iron-On (bottom).

So if you just have to use that dark or black shirt, first apply a layer of white glitter HTV in the same cutout shape (use the recommendations on the package for temp/duration), then put the Infusible Ink over top of it (I did it at 386°F for 40 seconds). Works great!

Get my free SVG designs for your Infusible Ink Projects!

If you make an Infusible Ink t-shirt with your Cricut, please share a photo in my helpful Cricut Facebook group or tag me on social media with #jennifermaker.

Love,

Want to remember this? Save the Cricut Infusible Ink T-Shirt Guide to your favorite Pinterest board!

27 Best Black T-shirts for Women to Buy Online in Australia

It’s a staple every woman should have in her fashion arsenal. Here’s how to find the perfect black T-shirt for your wardrobe.

Our recommendations are dedicated to helping you find the right product at the right price. We may receive revenue from affiliate and advertising partnerships for sharing this content and when you make a purchase. Learn more

The perks of the perfect white tee have been documented by the style set for decades. Yet where is the love for the fashion staple’s arguably more versatile twin, the black T-shirt?

Already a wardrobe MVP for new mums and messy eaters the world over, the perfect black tee is comfortable, flattering and helps those eye-catching prints to pop like no other.

We all know finding the kind of basic that works with every outfit (no matter the season’s sweat level!) can be like striking sartorial gold.

BEST BLACK T-SHIRTS TO TRY

Here’s where to find the best black T-shirt options to fit every personal style and budget.

THE BEST V-NECK T-SHIRTS

Stylish without looking like you’re trying too hard, the V-neck tee flatters every body, all the time.

Lorna Jane Women’s Frankie T-Shirt, Amazon, from $44.53

If you’re decidedly more at home racing around in performance wear you know will go the distance, this black T-shirt from Australian activewear brand Lorna Jane will do the trick. Created with lightweight, quick drying (see you later, sweat), 2 way stretch fabric that’s 65 per cent polyester and 35 per cent viscose, you can transition from brunch to barre class with ease. The V-neck and semi-relaxed fit is timeless and comfortable and you can just as easily pair it with jeans and sneakers as you can with leggings and joggers.

SHOP HERE

Short Sleeve Linen T-shirt, Country Road, $59.95

Breathability isn’t just for your lungs. Country Road’s Short Sleeve Linen T-shirt is ready to keep you comfortable no matter what the temperature. Featuring a touch of nylon to help your tee last the distance, this comfortable linen number adds a hint of low-key chic to any wardrobe, easily pairing with everything from printed skirts and block heels, to slides and slouchy drawstring pants.

SHOP HERE

Atmos & Here Curvy Essential Organic Cotton V-neck Tee, The Iconic, $19.99

Take one super-light organic cotton and viscose blend, add a flattering wide neckline, and finish with that perfect just-on-the-hip length. The Iconic’s exclusive Atmos & Here Curvy Essential V-neck Tee will be your number one contender for wear-everywhere comfort, whether it’s slipped under a statement blazer for your Monday morning meeting, or tucked into light denim for a Sunday afternoon shop.

SHOP HERE

The Organic Cotton V-neck, Everlane, $25

Everlane’s V-neck T-shirt is spun from Global Organic Textile Standard-approved cotton, providing peace of mind (and softness!) when it comes to wardrobe sustainability. This tee’s standard cut is anything but basic, with one happy customer saying the not too high, not too low neckline should see it renamed the ‘Goldilocks’ tee – otherwise known as just right.

SHOP HERE

CREW NECK T-SHIRTS

The standard, the staple, the shrug on and go – the crew neck T-shirt is your everyday best mate.

Assembly Label The Crew Tee, The Iconic, $40

Assembly Label’s Crew Tee is ribbed for your comfort, with the 100 per cent cotton fabrication providing just the slightest hint of natural stretch. This soft jersey blend ensures the classic cut T-shirt gives the perfect amount of drape, while the stepped hemline will sit perfectly – no matter whether you’re feeling tucked or untucked.

SHOP NOW

Park Tee, Camilla and Marc, $120

The super soft option of our crew neck bunch, Camilla and Marc’s Park tee is made from 55 per cent Modal and 45 per cent Cotton, a fabric blend almost as comfortable as wearing nothing at all. This oh-so-simple, yet chic, black T-shirt has the perfect longer length on lock, pairing with anything from activewear to evening wear.

SHOP HERE

The Attico Cotton Jersey T-shirt With Shoulder Pads, Luisaviaroma, $511

Shoulder pads are back, baby! The Attico’s luxe Cotton Jersey T-shirt takes its inspiration from a so-hot-right-now ‘80s silhouette. With an embroidered logo to front and a hint of stretch for comfort, this garment is all about those well-constructed shoulder pads – giving the illusion of hourglass curves. Tuck yours into a high-waisted skirt and get ready to take up space.

SHOP HERE

Cotton On Curve The One Crew Tee, Cotton On, $19.99

Available in sizes 16 to 24, Cotton On’s top-reviewed Curve The One Crew Tee features added fabric to the bust, waist and hips for a smidgen of extra comfort. This basic essential pairs a feminine short sleeve cut with a flattering relaxed neckline, giving that cheeky hint of collarbone without covering up too much.

SHOP HERE

THE BEST CROPPED T-SHIRTS

Perfect for balancing out a high-waisted bottom half, the cropped T-shirt adds low-key drama to jeans, track pants and swishy skirts.

The Organic Cotton Cropped Tee, Everlane, $29

With a dropped shoulder and elongated short sleeves, Everlane’s The Organic Cotton Cropped Tee will make effortlessly cool look easy. Featuring a shorter-than-average crop length, this T-shirt provides a winning top half for all your high-waisted looks, pairing with everything from wide leg plaid pants to rigid dark denim with ease.

SHOP HERE

Adidas By Stella McCartney ASMC Future Playground Cropped T-shirt, Luisaviaroma, $150

Take Adidas by Stella McCartney’s super cropped number from Saturday day to Saturday night by switching out your high-waisted shorts for a pair of high-rise mum jeans. Instantly recognised by its branded logo to sleeve and back, this streetwear-inspired tee offers stretch and comfort, courtesy of its organic cotton-recycled polyester blended fabrication. A garment you can look good – and feel good – about wearing.

SHOP HERE

The Baby Tee, Cotton On, $15

Cotton On’s 100 per cent cotton The Baby Tee is the wardrobe essential you didn’t know you needed. The cropped, boxy fit will work under or over any item you can throw at it, channel ‘90s grunge energy by pairing yours with a slip skirt and platform thongs. Plastic choker and chunky highlights not required.

SHOP HERE

RELAXED FIT T-SHIRTS

The coolest of silhouettes, an oversized or relaxed fit T-shirt can work both long and loose, or tucked in tight for that perfect drape.

The Air Scoop-Neck Tee, Everlane, $41

Air by name, air by nature. Everlane’s The Air Scoop-Neck tee is made from a super light cotton, making it a must-buy for those who prefer their fabrics on the delicate side. Featuring slightly-dropped sleeves and the ever-elusive U-shaped neckline, unearthing this winning basic is like finding an unscratched scratchie at the bottom of your handbag.

SHOP HERE

Rick Owens Minerva Cotton-Jersey T-shirt, Net-A-Porter,$365.43

Rick Owens‘ oversized Minerva Cotton-Jersey T-shirt is certainly a statement maker. A designer best known for his minimal silhouettes, Owens elevates a simple 100 per cent cotton tunic by adding an elegant high crew neck and trapeze style shape. Pair yours with luxe leather leggings and over-the-knee boots for an easy, breezy headturner of a look.

SHOP HERE

The Organic Cotton Boxy Raglan Tee, Everlane, $36

Raglan sleeves aren’t just for baseball. A home run pairing for ‘70s style high-waisted jeans, Everlane’s The Organic Cotton Boxy Raglan Tee has a host of rave reviews for its unique sleeve length. Roll yours up for that laid-back yet considered touch, or let them hang loose to add a bit of retro cool to your weekend.

SHOP HERE

The Oversized Dad Tee, Cotton On, $24.99

Oversized without being sloppy, Cotton On’s The Oversized Dad Tee is the chic way to do dad style right. The generous cut and slight stretch will keep you comfortable no matter the situation, it’s the perfect top to throw on over a streamlined bottom half when you just … can’t.

SHOP HERE

RIBBED T-SHIRTS

Your weekend away must-have, a soft ribbed T-shirt is the perfect bottom layer for warming up strappy slip dresses and jumpsuits.

Assembly Label Ida Rib Long Sleeve Tee, The Iconic, $50

Those Saturday morning kids’ sport sessions getting a little too breezy? Assembly Label’s Ida Rib Long Sleeve Tee is an easy layering piece. Made from a ribbed cotton-jersey with added stretch, this long sleeve number pairs the inner feeling of your cosiest pyjamas with the outward look of somebody who spent a lot more time getting ready this morning.

SHOP HERE

Janine Top, Reformation, $72

Reformation’s Janine Top is manufactured using an ultra-comfy spandex and TENCEL modal blend – a fibre produced from sustainable forests. This slim fit, ribbed basic is ready for just about anything you can throw at it – flowing printed pants, button-front mini skirts and oversized overalls are all readily accepted with ease.

SHOP HERE

Monki Magdalena Cotton Ribbed T-shirt, ASOS, $16

A budget-friendly organic cotton option that avoids looking cheap, Monki’s Magdalena Cotton Ribbed T-shirt is the cute way to be kind to the environment. Pairing a high crew neck with super short sleeves, this tiny tee is finished in a stretchy ribbed fabric. Make a silky slip dress daytime-ready by popping yours on underneath – extra points when paired with some sweet street sneaks.

SHOP HERE

LONG SLEEVE T-SHIRTS

Soft, versatile and far from basic – the perfect long sleeve T-shirt will have you feeling cosy yet stylish the moment you pop it on.

The Organic Cotton Oversized Long-Sleeve Tee, Everlane, $44

Inspired by laid-back vintage tees, Everlane’s environmentally friendly Organic Cotton Long-Sleeve Tee may just be the perfect basic to take you from couch to chic. Push up the sleeves, throw on a loafer and classic straight-cut jean – those dropped shoulders and fitted cuffs may just be your quickest route to nailing French girl style.

SHOP HERE

Everyday Long Sleeve V-neck Top, Cotton On, $19.99

With 47 five-star reviews, Cotton On’s Everyday Long Sleeve V-neck Top is clearly anything but basic. Featuring a slightly softened V-neck and fitted long sleeves, this stretchy cotton-elastane top is the perfect layering piece. Make the neckline a feature by tucking it into wide-leg skater jeans, or layer it under a colourful wrap dress or tunic for added warmth.

SHOP HERE

Bassike + NET SUSTAIN Organic Cotton-Jersey Top, Net-A-Porter, $360

Part of Net-A-Porter’s NET SUSTAIN edit, Bassike’s Organic Cotton-Jersey Top is the cosy, chic way to support a local and sustainable business. This slim fit, ultra-soft cotton long sleeve tee pairs a statement-making high neck with extra-long sleeves, providing the perfect backdrop for an eye-catching necklace. Wear yours tucked into slouchy, high-waisted suit pants for the ultimate in low-key style.

SHOP HERE

TURTLENECK T-SHIRTS

Get those Audrey Hepburn vibes pumping with an ever-classic, always-chic black turtleneck.

Kira Top, Reformation, $146

The fashion equivalent of a nice, warm hug, Reformation’s Kira Top is manufactured in an eco friendly stretch mix of TENCEL lyocell, organic cotton and spandex – just begging to wrap you up from neck to wrist. This relaxed fit, ribbed top pairs an ultra-chic high turtleneck with slightly dropped shoulders to create the perfect slouchy shape. Wear yours with tweedy trousers during the week, and fitted denim once the weekend begins.

SHOP HERE

The Air Turtleneck, Everlane, $55

Easily your number one layering candidate, Everlane‘s The Air turtleneck pairs perfectly with any windy day trans-seasonal look. The high roll neck and ultra-light cotton conjures up easy minimalist chic when tucked under a beige trench or hourglass blazer. With 80 five-star reviews and counting, this is one basic you shouldn’t let fly by.

SHOP HERE

Aris Midsleeve High Neck Top, The Iconic, $130

Short sleeve turtlenecks? Totally a thing. Aris’ sharp black Midsleeve High Neck Top is a fash pack dream. Tailor-made for the not-so-harsh Aussie winter, the diagonally-ribbed cotton-acrylic blend adds a touch of sheen to office-appropriate attire. Equally at home as an under-layer or centrepiece, pair yours with a glossy leather skirt or retro wide leg overalls for a head-turning silhouette.

SHOP HERE

TANK TOPS

Worked hard for those arms and ready to deploy them? The perfect tank top can be casual, dressy and everything in between.

Asymmetric Tank, Country Road, $59.95

As far as possible away from basic, the neckline on Country Road’s Asymmetric Tank is already turning heads for 225 happy five-star reviewers. This slim fit, cotton-polyester top is work-ready when paired with a flowy, wide leg pant, or dress it up for that special event with a full prom skirt and heels.

SHOP HERE

Belfort Top, Reformation, $100

Lightly padded shoulders are the defining feature of Reformation’s ultra-cool Belfort Top. Created in a medium weight, 100 per cent organic jersey, this slim fit, crew neck tank is ready to be the star of any casual outfit. Pair yours with high-waisted pants for the ultimate in fashion pack chic.

SHOP HERE

Canyon Top Es, Reformation, $58

Reformation‘s flattering on everybody Canyon Top is created from a ribbed lyocell-spandex blend, a fibre made by utilising eucalyptus trees. Available in a wide range of sizes from XS to 3XL, tuck this versatile straight neck tank top into high-waisted denim to show off a host of layered dainty gold necklaces.

SHOP HERE

The Turn Back Tank, Cotton On, $14.99

The ultimate in go-with-anything style, Cotton On’s Turn Back Tank pairs that flattering racerback with a high cut neck. The stretchy cotton-elastane blend makes this basic a comfortable option for warm Aussie days, add a flippy floral skirt and ultra-white sneakers to take this top from beachside to bar side in the blink of an eye.

SHOP HERE

HOW DO I STYLE A T-SHIRT FOR WORK?

Blazers, blazers, blazers. Sorry, did I mention blazers? A well-cut blazer will elevate your black T-shirt from beach to boardroom in a heartbeat. Try an oversized, androgynous option in classic tweed; or a jet black, single-breasted number for easy sophistication.

Working somewhere a little more laid-back? Lucky you! A smart T-shirt (read: not heavily distressed or faded) in a thicker fabric will look ace tucked into a pleated print skirt or high-waisted jean.

HOW DO I WASH BLACK T-SHIRTS?

Love your tee to death but worried it might start to look … dead? Colour fade is undoubtedly the mortal enemy of the black garment.

Ensure your black T-shirts stay their most pigmented by washing in cold water, giving rough machine cycles a miss (make friends with that gentle setting!), and avoid hanging them out to dry in direct sunlight.

WHAT KIND OF BRA SHOULD I WEAR WITH A T-SHIRT?

A T-shirt bra of course!

Look for a lightly padded style with smooth cups and minimal detailing, as those lacy loops will be visible under thin cotton fabrics. Seam-free styles work best, and above all, look for a comfy undergarment you’ll reach for just as often as the T-shirt itself.

Looking for the perfect outfit topper? To make that black T-shirt really shine, check out our special edit of denim jackets for women.

Looking for more style ideas and fashion staples? Check out our Best Of Fashion section. There you’ll find everything from the $39.99 sneakers that always sell out and 9 covetable lingerie brands to fill your top drawer with.

Lastly, news.com.au has all the best deals. Be sure to get the best prices on all your favourite brands – from Country Road to Cotton On – in our Coupon section.

How to choose a jacket for application? – News and articles

So that it fits well, retains its appearance for a long time, is pleasant to the body and easy to care for.

In this article we will talk about the materials and technologies for making shirts for women and men. Let’s consider different types of fabrics and show you what to look for when choosing shirts as corporate clothing.

Materials

Shirt fabric is made from cotton, polyester, silk, rayon or a blend of fibers.Pure cotton or blended fabrics are most commonly used.

Cotton

Cotton fabrics have good hygiene properties, eg hygroscopicity. They breathe well and absorb moisture. Cotton shirts practically do not “shrink” and do not deform during washing. And what is important – the price / quality conditions are met.

Cotton Blend

These fabrics are based on cotton, to which synthetic fibers are added to improve performance.Pure cotton fabrics wrinkle and get dirty faster. The addition of only 5% of polyester fibers makes the cotton fabric smoother, more durable, less brand – more suitable for everyday wear, for example, corporate shirts. At the same time, the “comfort” of such fabrics is almost not reduced.

A small amount of synthetic fibers, up to 30%, is the most optimal. When the amount of synthetic fibers approaches 50% or more, the “natural” properties of the fabric decrease. If you are faced with the task of choosing more “wearable” and affordable shirts, pay attention to shirts made from a mixture of cotton and synthetics.When ordering a large edition, it is important that such fabrics are cheaper.

In Sol’s shirts, the cotton / synthetics proportions are perfectly adjusted, they retain the best properties of natural fibers, and also show the advantages of synthetics – wear resistance, crease resistance, ease of care.

Popular blended fabrics:

  • Cotton / polyester blend. Polyester fibers hardly wrinkle and dry quickly. Such shirts retain their shape longer and wear little.
  • Cotton / Elastane Blend (Lycra / Spandex). This fabric stretches well and is especially good for creating tight-fitting shirts.

Technology

The degree of twist of the yarn also affects the properties of the fabric. Distinguish:

  • Single-strand – obtained by twisting in one step two, three or more threads of the same length. Most office shirt fabrics are made from cabled yarn.
  • Multi-stranded – resulting from two or more twisting processes.So, to obtain a two-fold yarn, part of the threads is first twisted, and then, folding them, they are twisted again. The fabric obtained from this yarn is more durable and wear-resistant. The complication of technology increases the final price of the fabric.

Harvest shirts are made from fabric made from double twist yarns.

Density affects the consumer properties of the fabric, its plasticity and strength. The density index depends on the thickness, degree of twist and additional processing of the thread, as well as on the type of weaving.

If the yarn is tightly twisted, and the threads are tightly adjacent to each other in the fabric, the fabric will be stronger, but stiffer. The fabric with the same density value from different manufacturers may be different: more or less thin (more or less transparent to the light). The reason is different production and processing technologies.

Density can be measured in g / m 2 (weight / area) or D (“denier”, weight in grams per 9000 meters of thread).

Types of fabrics

The look and type of fabric is determined by the interweaving of the warp and weft threads.The warp threads (share) run in the fabric along the edge, the weft threads – across. In the process of weaving, the weft shuttle slips between the stretched warp threads, which are lowered or raised according to the weaving pattern.

Main fabric types:

  • Plain weave (eg poplin)
  • Matte weave (Oxford)
  • Twill weave
  • Jacquard weave
Poplin

Papal fabric.The homeland of poplin is the French city of Avignon, where the residence of the Pope was located; the first mentions of this fabric date back to the XIV century. Double-sided, formed by a combination of a thin dense warp with a coarser and thinner transverse weft, forming a fine rib.

Features:

Poplin – plain weave and warp threads. The density of the warp is 1.5-2 times higher than the density of the weft threads. Thus, a small transverse scar is visible on the front side.The most appropriate poplin shirts look classic for more formal situations.

Varieties:

  • Poplin – 100% cotton
  • Poly-cotton poplin – cotton blend with added polyester
  • Stretch poplin – fabric contains elastane (Lycra / Spandex)
Oxford

Fabric type with weave type “matting”, traditionally used for sewing men’s shirts.

Oxford fabric got its name from the creators – owners of a textile factory in Scotland.Oxford fabric appeared in the 19th century and was originally made from pure cotton, but now various synthetic fibers such as polyester are added to this fabric.

Features:

  • The weft is thicker than the warp.
  • To create oxford fabric, dyed and undyed yarns are used, achieving a textured effect. Oxford shirts are low maintenance. The fabric is lightweight and breathable, so it is perfect for sewing summer shirts for men.
Twill

Shirts made of twill weave, such as twill, feature a weave pattern of parallel diagonal veins.

Features:

  • Very good drape.
  • Divided into front and back.
  • The weave pattern is more clearly visible on the obverse.
  • Striped shirts look especially good.
Jacquard

Fabric, the interlacing of the threads in which forms an embossed pattern.

A special machine for making this kind of weaving was invented back in 1801 by Joseph Marie Jacquard.

Jacquard fabrics look more elegant than other weaves.

Finishing fabric

After fabrication, the fabric must be finished. This is an important stage, because it is the processing that gives the fabric its final look and gives it additional properties.

Finishing of the fabric can include dyeing, finishing (impregnation for stiffening) and special treatment (waterproof, fireproof, and others).

Easy Care – treatment with a wash-resistant polymer composition. Must have for office shirts. It is applied on 100% cotton fabrics, provides easy ironing and allows you to keep the shape longer. Clothes with such processing do not require special care. Most Harvest and Sol’s shirts are Easy Care.

What else is worth paying attention to
  • Compliance with cutting technology affects the quality of the shirt. With the correct layout of the patterns, the parts will retain their shape, and will shrink evenly after washing.Unscrupulous manufacturers, saving fabric, can violate the technology. Parts cut out incorrectly are deformed after the first wash. You can’t wear such a shirt a second time.
  • Pay attention to the quality of the seams. Good shirts have clean seams, while cheaper shirts use an overlock.
  • In a quality shirt, the collar retains its shape even after many washes. This is influenced not only by the quality of the doubler seal, but also by the use of special stiffeners – plastic inserts.
  • Stamped buttons made from cheap plastic that can melt under the iron should be avoided.

Harvest and Sol’s office shirts meet all quality requirements. In addition, almost all models are complementary – there are both male and female versions.

Previous mailings

Subscribe to our newsletter to be the first to receive interesting articles.
When reprinting and citing text, follow the Rules for the use of materials.Used images not belonging to Project 111 are distributed under a Creative Commons license. Cotton Harvest, Kimberly Vardeman, CC BY 2.0 license.

reviews, photos and characteristics on Aredi.ru

We deliver parcels to Kaliningrad and ship all over Russia

  • 1

    The goods are delivered from the seller to our warehouse in Poland. Tracking number not
    provided.

  • 2

    After the goods have come to our warehouse, we arrange delivery to Kaliningrad.

  • 3

    The order is sent by courier service EMS or Russian Post. Notification with track number you
    receive by SMS and email.

!

The manager will expose the estimated cost of delivery in Russia after
placing an order.

Warranties and Returns

Guarantees
We work under an offer agreement, which is a legal guarantee that we will fulfill
their obligations.

Return of goods
If the goods do not fit you, or do not correspond to the description, you can return it by paying
return shipping cost.

  • You will have all the payment receipts, which are confirmation of the transaction.
  • We redeem goods only from trusted sites and from trusted sellers who are fully responsible for the delivery of the goods.
  • We give real tracking numbers for shipment of goods in Russia and provide all the necessary documents upon request.
  • 5 years of successful work and thousands of satisfied customers.

90,000 How to Iron a Black Shirt – Builders Club

Every person needs to know how to iron a shirt, in what mode and at what temperature. This is not the easiest procedure that requires certain skills, experience and accuracy. It is important not only to iron out all the irregularities, but also not to damage the material, not to spoil the buttons, and not to lead to the appearance of dark spots due to an iron that is too hot.Ironing begins with preparation. You need to follow the sequence and know the capabilities of your own iron, or its analogues.

How to select the heating mode

Dry the shirt using a hanger before ironing. But you shouldn’t dry your clothes too much. If you do dry out, then use a spray bottle, slightly dampening the cloth just before you start ironing.

Before plugging in the iron and ironing, you should read the instructions for the device and select the correct heating mode.It depends on what material the shirt is made of. Look for such information on the tag. The temperature regime is usually indicated there.

Just take a look at the seamy side of the garment. If there is no tag, then start with mode 2, gradually increasing the heating temperature if necessary.

When the iron starts to slip hard, this indicates an excessively high temperature – you cannot iron this way.

To determine the required heating, it is better to start from the material.The temperature and mode are chosen as follows:

  • For natural cotton, the temperature is 150 degrees. At the same time, the strong steam mode turns on, and you need to iron with some effort.
  • A combination of cotton and linen is ironed at temperatures from 180 to 200 degrees and with high steam.
  • Polyester with cotton should not be heated above 110 degrees. The steam is small.
  • If the shirt has a wrinkled or wrinkled effect, keep the temperature at 110 degrees, and do not use steam.
  • Viscose needs 120 degrees.You can use steam, but you should not wet the fabric.
  • A shirt based on pure linen requires a high temperature – from 210 to 230 degrees. In this case, you will have to make an effort by pressing your hand on the device.

If you have several ironing modes, but you cannot decipher them, take a look at the instructions. Usually it indicates what this or that mode means, and how much the iron heats up at 1, 2 or 3 mark.

How to properly iron a men’s shirt with an iron: how to work

Ironing is divided into several sections, within which the emphasis is on the different constituent parts of the garment.

Collar

Let’s start with how to iron the shirt collar correctly. Here it is important to pull out the bone, if there is one under the collar, turn it inside out and walk with a hot device at the correct mode. Smoothing from the center, gradually move towards the corners of the collar. Repeat the same steps on the front side. Pay special attention to the corners when ironing the shirt to avoid wrinkling the fabric.

Sleeves and cuffs

Ironing on cuffs and sleeves is the hardest part.Depending on the specific type of clothing and whether a jacket will be worn over it, sometimes you need to make arrows or try to avoid their appearance.

Let’s look at how to iron the sleeves of a shirt without arrows, while also touching the cuffs. The simplest thing is to use a special nozzle designed specifically for ironing cuffs and sleeves. But you can do without it.

  • Spread the sleeves along the board, undo the buttons on the cuff.
  • It is recommended to start ironing with the cuff, ironing it on both sides.If the cuff is double, first iron it unfolded, as usual, and after folding, making sure that the loops coincide, it remains to iron along the fold.
  • When ironing a men’s shirt with long sleeves, you should try to get rid of the arrows. To do this, align the sleeve and place it on the edge of the board. Do not run the iron all the way to the fold line. Iron gently in the desired mode.
  • Next, the sleeve is turned over so that the fold line is in the center. Now go over the center of the sleeve. Similar manipulations are carried out with the second sleeve.Be careful not to iron the arrows and force yourself to do this procedure again.

Sometimes it is necessary to have an arrow on the shirt – this is often true for products with short sleeves. Simply tuck the garment so that the arrow runs from the shoulder seam to the cuff. Please note that the arrows on the cuff should always be smoothed out.

A simple method can be used to save time and effort on ironing the sleeves of a shirt.For this, an ordinary rolling pin or bottle is taken, wrapped in a terry towel, and a kind of roller is obtained. Insert it into the sleeve and iron it on all sides.

Shoulder

To iron the shoulders, use the narrow section of the board – put on a shirt. The product is placed on the edge of the ironing surface in such a way as to first iron the left shoulder and then the right shoulder, or vice versa.

Make the most of the iron spout to reach tricky areas and get rid of all wrinkles.Once one shoulder is smoothed, start working on the next.

Front and back

It is important to be able to iron the front and back of the shirt correctly:

  • It is better to start from the part where the buttons are sewn. Place the shirt on the board, trying to cover most of the front of the garment.
  • Walk carefully around the collar so that there are no wrinkles, as even from under the tie it will be visible.
  • Iron around buttons, but do not use an iron over them as plastic melts easily when exposed to high temperatures.Or just turn the shirt inside out before ironing.
  • Now drag the garment so that the back of the garment is on the board. Depending on the board, usually half to 2/3 of the clothing will fit on the work surface.
  • When ironing, focus on the area near the collar.
  • When you have finished with the back part, proceed again to the front, but this time from the side where there are no buttons. Walk well over the chest pocket area, if any. Do not forget about the space near the collar.

Since the main part of the shirt is ironed at this stage, and the procedure is carried out quickly, there are usually no problems with the front and back. The main thing here is not to forget about the available small areas near the collar and pocket. It is even better to bypass all the buttons on the shirt with an iron so as not to spoil them.

Quality control

There is nothing particularly difficult in ironing a shirt yourself, no. Watch out for wrinkles, follow the sequence and do not forget about the choice of the mode.

When finished, check for poorly ironed areas or areas that you might have overlooked. If all is well, hang your clothes on a hanger.

If you notice any flaws, use the iron that has not yet cooled down, eliminating the flaws.

Not knowing exactly what material the shirt is made of, it is better to use a low temperature, increasing it if necessary. It will take longer to iron the clothes, but it will not burn them.

What is definitely not worth doing is ironing dirty shirts that have not been washed. When smoothing out stains, it will be much more difficult to remove them in the future. Some iron stains will remain permanently.

Ironing of shirts with other devices

There is a lot of controversy about what is the best way to iron shirts and what equipment to use for this. Lovers of the classic approach do not perceive anything other than an iron. But there are also alternative solutions that are not inferior to the iron, and sometimes allow you to iron men’s shirts even better, faster and better:

  • steam generators;
  • steamers;
  • 90,031 steam dummies.

Steam generator

If you already know how to properly iron your shirt using a regular iron, working with a steam generator will not cause you any difficulties.

This is almost the same iron, only with increased power and a constant hot steam function. Compared to a conventional iron, the steam jet is much more powerful, which makes ironing clothes made of different materials faster and easier.

Steam generators are not applicable to all shirts, but only to those for which steam is allowed.

Steamer

The essence of the device’s operation is the supply of hot steam in a dense flow. The steamer is not an analogue of an iron and will not be able to replace it completely in everyday life.

Steamers are well suited in situations where you need to freshen clothes, iron them after storage, get rid of foreign odors without washing. An important feature of the device is its ability to iron clothes suspended vertically.

Steam dummy

This is a mannequin that can be deflated and inflated to certain limits, which allows it to take the form of shirts of different sizes.Serves to dry and iron products.

Steam dummies are rarely used in everyday life and for personal use. They are expensive and difficult to buy.

How to iron a shirt without an iron

It so happens that there are no instruments at hand, and the shirt is wrinkled and needs to be ironed. To get out of this situation with dignity, you can use several ways:

  1. If the shirt is slightly wrinkled, wet your hand with water and run it over the garment.You need to make sharp movements, moving from top to bottom. Then shake off the clothes, leave to dry. Make sure your hands and the water you use are clean. The method is suitable for linen shirts.
  2. There is another method for synthetics, chiffon or silk. You need to take a hanger, hang a shirt on them in the bathroom, turn on a hot shower, but so that water does not get on your clothes. Close the doors, leave the shirt in a steam environment. Steam will help remove bruises.
  3. Using a spray bottle, dampen the cloth a little and put it on.This is a good option for ironing clothes that are smoothed by tension.
  4. If the shirt is made from natural materials, not synthetics, there is another way. Mix water, vinegar, and any fabric softener. The proportions are equal. The resulting liquid is poured into a spray bottle and applied to a crumpled shirt. All wrinkles are smoothed out pretty quickly, and the conditioner hides the vinegar smell. But it still does not hurt to ventilate.

Going on a business trip or vacation, when a shirt is still required, it will not be superfluous to grab an iron.Good hotels can iron your clothes for a nominal fee.

Tips and life hacks for the perfect look

Knowing how to iron the shirt sleeves, back, front and collar correctly, you will be able to maintain the perfect image and well-groomed appearance. When starting to iron a white, black or colored shirt, there are a few additional tips to consider:

  • If this is a men’s shirt, then it is customary to iron it from the front side, without turning it inside out.
  • But if the shirt is dark, it is better to turn it inside out so as not to leave traces of the iron.
  • Some shirts stubbornly refuse to iron. Even strong steam will not help here. It would be more correct to moisturize the product and iron difficult areas with strong pressure.
  • If fabrics are difficult to iron, you can use the Moistening Method by mixing water and conditioner.
  • Prints and embroidery on shirts are best ironed from the wrong side. Place an ordinary sheet of paper under the drawings themselves, otherwise it may be printed on the board.
  • To make ironing easier, use a coat hanger to dry and start ironing while the shirt is still slightly damp. It is not recommended to twist and dry shirts strongly with a washing machine.
  • When finished ironing, be sure to remove the clothes from the board, hang them on a hanger and let cool completely. Otherwise, bruises will remain on the shirt.

It is not so difficult to master the process of ironing a shirt if you approach this task correctly.

Every time you go to work or find yourself in a crowded place, willingly not willingly, you pay attention to men who are walking around in a crumpled shirt. They wear expensive clothes, fashion brands, but all this fades when a person is sloppy. This is especially common among junior office workers who went to university yesterday. It’s good if mom knows how to iron a shirt properly, and someone has a wife who watches over her husband’s neatness. However, there are men who have neither the knowledge nor the desire to iron shirts, believing that this is a waste of time.Is it so?

Contents:

The fact is that both young and adult men, for the most part, do not know how to iron a shirt properly. There is nothing shameful in this, but many hide behind excuses, they say this is not a man’s business and in general nothing is visible under the jacket. But a man should be self-sufficient and be able to iron not only a shirt, but also sew on a button, if necessary. And by the way, not an ironed shirt, as you can see from under the lapels of the jacket, especially the collar of the shirt.

The importance of a business man’s neatness is difficult to question when it comes to interviewing for a new job or meeting with a business partner. Remember the saying: “they are greeted by their clothes, but they are seen off according to their minds”? By having a neat appearance, you demonstrate your discipline and order. If even your appearance suggests that you do not pay attention to even such simple trifles and do not take care of yourself, then who wants to deal with you?

Give yours to the girl, this is her job

In fact, ironing a shirt is not as difficult as it seems at first glance.With a modest amount of knowledge, it is possible to iron one shirt in less than 5 minutes. If you are convinced by my arguments, then I propose to study several recommendations on how to iron a shirt correctly.

How to iron a shirt

The first thing to do is turn the shirt inside out. This way you will achieve the best results, especially on thick cotton shirts.

Gray shirt with a pattern from Henderson

Classic white shirt from Henderson

Plain blue shirt from Henderson

White shirt with pinstripes from Henderson

Read the label that has the recommended temperature for the iron (iron icon, no dot).If there is no such icon, then look at the type of fabric and set the temperature on the iron, according to the manual from the iron manufacturer. As a rule, on irons, the temperature regime is indicated from 1 point to 3 points. Sometimes the type of fabric is signed next to a particular point.

Most shirts are made of cotton or cotton with the addition of another type of fabric. Make sure your shirt is free of synthetics, or you could burn your shirt from the hot iron. If there is no shortcut, try starting at a low temperature.If the folds are not ironed well, turn up the temperature a little. As soon as you feel that the iron starts to slip poorly, immediately pause ironing and reduce the temperature of the iron.

Moisten the shirt before ironing

For the convenience of ironing, I recommend not to dry the shirt too much, but to leave it slightly damp. Not wet, so that it drips, but a little wet, as if you were caught in the rain a couple of hours ago and were almost dry. Believe me, the shirt will be much easier to iron.From my experience I can add that after washing the next batch of shirts (there are, as a rule, 5 – 6 of them), I let them dry all night, and in the morning I put them in a pile a little damp and try to iron them for 2-3 days. During this time, they do not dry out completely and can be easily stroked over the weekend. If this is too difficult or inconvenient for you, just spray water directly while ironing the shirt.

Immediately after ironing the shirt, hang it on the back of a chair or directly on the hanger in the closet.Do not throw your ironed shirt on the sofa or anywhere else, do not spoil your work.

Next, I will tell you about the method that I use myself. There are other ways on the Internet, but they are not convenient for me personally. So, let’s begin.

1. Ironing sleeves and cuffs

Ironing the sleeves of a shirt is, in my opinion, the most difficult task, so start the best with it. Sleeves can be sewn in different ways and ironing is easier or more difficult. Take the sleeve along the seam and place it on the ironing board.Try to flatten the underside of the sleeve so that there are no strong wrinkles under the top layer of the fabric. I am right-handed, so it is more convenient for me to put the shirt so that the cuff of the shirt starts on the right, and the rest of the shirt on the left. The first step is to iron the sleeve so that no wrinkles remain. Please note that when you have walked along the seam with the iron, you need to move it slightly (imagine that there is a roller in front of you, not a sleeve, and turn this “roller” a little) and again go through the iron, but this time do not touch the edge sleeves.Then I iron the cuff by laying it flat on the ironing board. Carefully work around the buttons and folds that form at the junction of the cuff and sleeve. Do the same with the second sleeve, being careful not to wrinkle the ironed part.

If you have a special stand for ironing sleeves (such a mini ironing board), then ironing the sleeves becomes even easier.

Why do I start ironing from the sleeves, and not like the rest of the Internet from the collar or front of the shirt? The fact is that having ironed the front and back of the shirt, you will then have to fold the already ironed part in order to iron the sleeves.It often happens that the sleeve cannot be ironed the first time (reasons: a cold iron, the water in the iron has run out or we forgot to pour it, a complicated shirt or delicate fabric, just in the morning the hands do not work normally, and so on), and we have to go there – here fidget your shirt in order to achieve a good result. As a result, the shirt is wrinkled again and it is necessary to iron it.

Iron sleeves and cuffs

2. Ironing the front and back of the shirt

Start from the part where the buttons are sewn.Position the shirt as shown and iron the shirt thoroughly. Pay attention to the area close to the collar, as this part is visible from under the tie.

Attention! Gently iron around the buttons. Do not iron the buttons themselves, they may melt (if you choose not to turn the shirt inside out).

Next, drag the shirt so that you have the back of the shirt (usually half of the back or 2/3 of it). Iron the entire area, focusing on the area around the shirt collar.I recommend not ironing on patches and labels that are made of synthetics. If the iron is hot, the edge of the label may melt a little, and then harden and scratch your neck if you do not wear undershirts.

After ironing the back of the shirt, move to the front of the shirt, where there are no buttons (this is usually the right side of the shirt). Carefully iron the chest pocket area and the pocket (if any). Again, iron the area around the collar well.

Ironing the front and back of the shirt

Iron around the buttons, not over them

3. Ironing the shoulders of the shirt

The next step is to iron the shoulders of the shirt. To do this, slide the shirt over the narrow part of the ironing board so that only your left or right shoulder can be ironed. Try to reach difficult areas with the tip of the iron so that no wrinkles remain. Once you’re done with one shoulder, move on to the second.

Ironing the shoulders of a shirt

4.Ironing shirt collar

If you forgot to remove the bones from the collars (this is done before washing), then remove the bones now. It happens that they are sewn in a collar, then do nothing with them. Fold out the collar of the shirt with the inside facing you. Try to get rid of all the folds at the corners of the collar, as this is the part that catches the eye of the people around you first.

Iron the collar without creases

5. Check the folds and hang the shirt

See if there are any wrinkled areas on the shirt.If everything is ok, hang it on a hanger and place the shirt in your closet.

A few tips

  • If you are unsure of the type of fabric your shirt is made of, always start ironing at a low temperature. Perhaps you will spend a little more time ironing, but you will not burn it.
  • Always iron around buttons, not over buttons. Even if the buttons are under the fabric (in case the shirt is inside out), still go around the buttons when ironing.
  • Do not iron a dirty shirt if it has not been washed. If you iron the stains on the shirt, it will be extremely difficult, if not impossible, to wash the shirt later.

Cleaning the iron

If you, like me, have hard water at home and mineral deposits constantly accumulate in the iron, then I recommend cleaning it sometimes. To do this, pour a solution into the water tank: 1 part – water, 1 part acetic acid. They say that you can still citric acid, but the concentrate will come out much more expensive than plain table vinegar (the concentration of vinegar is about 70%).Pour in the solution, heat the iron and place it on the ironing board with the soleplate down, so that the steam comes out from under it. When all the water runs out, see how much dirt has accumulated in the iron. Repeat the procedure if necessary. To prevent this from happening, fill in purified water if you have a flow filter or bottled water, if possible.

Knowing how to iron a shirt properly, you will never be afraid of a mountain of crumpled shirts. Practice a little, ironing a couple of dozen shirts, and the time spent ironing one shirt will be reduced to insignificant 3-4 minutes.To slightly diversify the process of ironing wrinkled shirts, parallel watching TV or listening to the radio will help. I hope you have the patience to learn this not difficult but necessary skill.

Every woman wants her beloved man to look neat, and his shirts are always perfectly clean and ironed. Although many, especially young housewives, do not know how to iron a long-sleeved shirt correctly. Although there is nothing difficult in this. If you know some of the secrets, this lesson will not take much time and effort.

Basic rules

There are several rules for ironing a long sleeve shirt. Fulfilling these conditions, the ironing process will become a pleasant procedure for women.

Ironing of shirts shall be carried out as follows:

  • A men’s shirt should only be dried on a hanger, and before that it should be straightened and shaken. In this case, bruises and wrinkles will form on it, and you can iron the shirt quickly and easily.
  • This garment attribute can only be ironed when wet, so a spray bottle must be prepared in order to moisturize the garment.
  • If the shirt is dark, then iron the man’s shirt from the wrong side. If you do not do this, then the fabric will soon become dull or may become glazed altogether. This is especially true for clothes made of shiny fabrics.
  • Each material requires its own ironing mode. The wrong temperature can ruin the shirt, burn it or burn a stain in it.And if the setting is too low, it will simply not be possible to iron out the wrinkles on the clothes. Also, not every material can be steam treated or humidified.
  • The product begins to be ironed from small parts, gradually moving to large parts. The back is ironed last. It is this order that allows the previously ironed parts to not be wrinkled.

In addition, each product has a label indicating the optimal ironing mode.Therefore, before ironing, you can clarify which mode is required.

Preparatory process

Before you start ironing, you need to prepare the available tools that you may need. Namely, an iron, an ironing board and a spray bottle. It is desirable that the board has a special device for ironing sleeves. It is she who allows you to iron the sleeves of a shirt without arrows. But you can replace this device with other available means, for example, a rolled towel.

If the iron does not have a steaming function, then you will need a spray bottle with water. And also two towels, but always light in color, so as not to stain the white shirt. One must be spread on the surface of the ironing board. Through the second, it will be possible to iron the shirt so that stains do not form on it, and it could not lose color.

Correct ironing mode

Each material requires its own temperature and humidity. And if the composition of the fabric from which the shirt is sewn is not known, then it is best to start ironing from the minimum mode.

Correspondence of materials to ironing mode is as follows:

  • cotton products (100%) – 150 degrees, the material can be steamed;
  • crumpled cotton – 110 degrees, but cannot be steamed;
  • 90,031 linen shirts – 210-230 degrees, strong steam;

  • viscose – 120 degrees, no steaming.

Silk items are generally ironed very well, but it is better to do this without steam, as the shirt can become shiny.You need to iron such a product only from the seamy side at the lowest setting.

Stages of ironing shirts

The process of ironing a men’s shirt should be started with small parts. First of all, you need to steam the collar and cuffs from the wrong side. The iron is pushed from the edge to the center so that wrinkles do not form. After that, you need to turn the product over and repeat all the manipulations. You cannot iron the collar along the fold, this will give it an irregular shape and ruin the appearance of a man’s shirt.

The cuffs are ironed after the collar. The ironing technique is the same as for the collar. First, the sleeves must be unbuttoned and straightened. If the product has double cuffs, then they are first ironed in the unfolded state, and then ironed along the fold.

Next, the most difficult part of the man’s shirt is ironed – the sleeves. It is necessary to do this so that arrows do not form on them, they must be perfectly smooth and even. To do this, the sleeves are straightened on an ironing board and folded in half.It is necessary to be guided strictly by the seam of the product.

Ironing is performed from the shoulder line towards the cuff. But do not iron very close to the edge, it is from this that unnecessary arrows appear. After one side has been ironed, the product is lifted and unfolded so that the seam is at the bottom and is located exactly in the middle. Then, the rest of the sleeve is ironed. The same manipulations are performed with the second sleeve.

The easiest way to iron the sleeves is on a special iron that is included with modern ironing boards.You can also use a rolled towel for this. This will not only help to avoid arrows, but will also significantly speed up the ironing process.

Then they begin to iron the shelves, while they begin to iron the side on which the buttons are located. First, smoothen the area around them, while you cannot iron over the buttons, since after such ironing, ugly marks form on the shirt. After that, the rest is ironed, it is necessary to move strictly from top to bottom.But the pocket, on the contrary, is ironed from the bottom up, such actions help to avoid the appearance of folds. Do the same with the second shelf.

The back is ironed last, this is the lightest part of the shirt. To do this, it is necessary to unfold and straighten the product on the ironing board so that wrinkles do not appear after ironing. In this case, you need to position the item so that the sleeve is near the long edge of the board. All iron movements should be done from top to bottom. Start at the shoulder line and gradually move to the edge.

After one half has been ironed, turn the man’s shirt over.

Related Posts

Leave a Reply

Your email address will not be published. Required fields are marked *